PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0033s0238.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 229aa    MW: 26389.2 Da    PI: 9.7287
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0033s0238.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.32.8e-1321106899
                          -HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3   8 sdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                           d l  ++l++p +f+ ++ +g+   +   tl + s   We  +  ++  +++++++GW++F +++ L   + ++F+++g++ f  +v+v
  Kaladp0033s0238.1.p  21 RDDLHAKNLRVPPQFM-KYlSGD--LTDHATLITHSTACWEAAI--SRAEETIYFKGGWENFFEDHSLGHDELLMFTYKGNMHF--HVRV 103
                          45555566********.555666..44579999***********..**********************************9*99..9999 PP

                          E-S CS
                   B3  97 frk 99 
                          f +
  Kaladp0033s0238.1.p 104 FGR 106
                          876 PP

2B347.92.5e-151502271898
                          --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                          lp + ++++ ++++++ t  ++   gr+W+vk+  ++  g++ ++kGW++Fv++n+Lk gD++ F+  +  + el+v+vfr
  Kaladp0033s0238.1.p 150 LPIPTTANMILNPPREATNFVMRCGGRVWDVKC-LQNAAGKHRFSKGWRNFVRDNELKPGDTCAFE--QVATYELRVTVFR 227
                          566666566677778888899999*********.7899999*************************..4478888999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.6E-1810108IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-1913109IPR015300DNA-binding pseudobarrel domain
CDDcd100173.19E-1014104No hitNo description
PROSITE profilePS5086310.6314107IPR003340B3 DNA binding domain
SMARTSM010192.6E-1016107IPR003340B3 DNA binding domain
PfamPF023625.7E-1019105IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-19127227IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.88E-20128227IPR015300DNA-binding pseudobarrel domain
CDDcd100175.90E-17133227No hitNo description
SMARTSM010190.0031135228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.52135228IPR003340B3 DNA binding domain
PfamPF023629.9E-13150227IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MATRSRSVNS GKEKSFIAIM RDDLHAKNLR VPPQFMKYLS GDLTDHATLI THSTACWEAA  60
ISRAEETIYF KGGWENFFED HSLGHDELLM FTYKGNMHFH VRVFGRDRCL RTQNARPQIQ  120
RQLPGESFTS SFPHFKICLR KSSFQPFYLL PIPTTANMIL NPPREATNFV MRCGGRVWDV  180
KCLQNAAGKH RFSKGWRNFV RDNELKPGDT CAFEQVATYE LRVTVFRC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01580.11e-12B3 family protein